PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016467664.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 450aa    MW: 48547.4 Da    PI: 5.5942
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016467664.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.85.9e-14133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W++I+r+    Rt+ q+ s+ qk+
   XP_016467664.1 133 AWTAEEHRLFLQGLEKYGRGDWRSISRHCVVSRTPTQVASHAQKF 177
                      7*****************************9************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512935.4434296IPR017884SANT domain
SMARTSM007170.00194394IPR001005SANT/Myb domain
SuperFamilySSF466891.51E-84699IPR009057Homeodomain-like
CDDcd001677.13E-54692No hitNo description
PROSITE profilePS5129418.979126182IPR017930Myb domain
SuperFamilySSF466891.72E-16128183IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-16130180IPR006447Myb domain, plants
SMARTSM007172.2E-11130180IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-11131173IPR009057Homeodomain-like
PfamPF002494.8E-11133176IPR001005SANT/Myb domain
CDDcd001675.49E-11133178No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MGSELFNSLT IAVPNGKFSG LTPGGPSIAS VMQLATALVK TCNSSSWTKE EDRAFETALA  60
IYAGDSNQLM KIAAAVPRKS IPEILQHYKK LVDDINDIEA GKVPLPQYGR MQGCSSRRSR  120
LSGAEVERRK GVAWTAEEHR LFLQGLEKYG RGDWRSISRH CVVSRTPTQV ASHAQKFFSR  180
LKDNNKAKRR RSIHDITSVD AATTEPSQGQ KTEKLNGPCG GQLQWPITDY VTEAFDPGMF  240
PLPGPVTNCM TDAIGGPSGV NHENFPFGTA VVSELNSSHP NVDDEFLLGV EDLITVPTQG  300
TSEAWHGVDT TTFPSLSWQP SFAGGAGMYT HPVNNVEYEM EELITKQLVE ATQVGPIVNT  360
TRLPLSIADH IGVHGCTASS SGAKNGFEST VGAPEAGLSV NSNPLMSIPG TSGGGVYPNF  420
NASIKDDNIF DLEDLFPDHM IGFYEKDGKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631818.10.0PREDICTED: uncharacterized protein LOC104121509 isoform X1
RefseqXP_009631817.10.0PREDICTED: uncharacterized protein LOC104121509 isoform X1
RefseqXP_016467664.10.0PREDICTED: uncharacterized protein LOC107790243 isoform X1
TrEMBLA0A0V0J0A01e-142A0A0V0J0A0_SOLCH; Putative ovule protein
TrEMBLQ94GD41e-138Q94GD4_SOLDE; Putative I-box binding factor, identical
TrEMBLM1BM041e-138M1BM04_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000481331e-137(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139501113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-53MYB family protein